Lineage for d2cxda1 (2cxd A:1-94)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651675Fold a.246: Hyaluronidase domain-like [140656] (2 superfamilies)
    5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology
  4. 651691Superfamily a.246.2: TTHA0068-like [140663] (1 family) (S)
  5. 651692Family a.246.2.1: TTHA0068-like [140664] (2 protein domains)
    Pfam PF03745; DUF309
  6. 651696Protein Hypothetical protein TTHA0068 [140667] (1 species)
  7. 651697Species Thermus thermophilus [TaxId:274] [140668] (2 PDB entries)
  8. 651699Domain d2cxda1: 2cxd A:1-94 [130994]
    automatically matched to 2CWY A:1-94

Details for d2cxda1

PDB Entry: 2cxd (more details), 2 Å

PDB Description: Crystal structure of conserved hypothetical protein, TTHA0068 from Thermus thermophilus HB8
PDB Compounds: (A:) conserved hypothetical protein, TTHA0068

SCOP Domain Sequences for d2cxda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cxda1 a.246.2.1 (A:1-94) Hypothetical protein TTHA0068 {Thermus thermophilus [TaxId: 274]}
mvpdweevlglwragryyevhevlepywlkatgeerrllqgvillaaalhqrrlgrpglr
nlrkaearleglpcplmgldwrsllqearrrlga

SCOP Domain Coordinates for d2cxda1:

Click to download the PDB-style file with coordinates for d2cxda1.
(The format of our PDB-style files is described here.)

Timeline for d2cxda1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2cxdb1