Lineage for d2cvdc2 (2cvd C:2-75)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1600814Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1601276Protein Class sigma GST [81362] (5 species)
  7. 1601289Species Human (Homo sapiens) [TaxId:9606] [89705] (7 PDB entries)
    Uniprot O60760
    synonym: hematopoietic prostaglandin D synthase
  8. 1601292Domain d2cvdc2: 2cvd C:2-75 [130866]
    Other proteins in same PDB: d2cvda1, d2cvdb1, d2cvdc1, d2cvdd1
    automated match to d1iyha2
    complexed with gol, gsh, hql, mg

Details for d2cvdc2

PDB Entry: 2cvd (more details), 1.45 Å

PDB Description: Crystal structure analysis of human hematopoietic prostaglandin D synthase complexed with HQL-79
PDB Compounds: (C:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d2cvdc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cvdc2 c.47.1.5 (C:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

SCOPe Domain Coordinates for d2cvdc2:

Click to download the PDB-style file with coordinates for d2cvdc2.
(The format of our PDB-style files is described here.)

Timeline for d2cvdc2: