SCOP 1.73: Domain d2cvdc2: 2cvd C:2-75

Lineage for d2cvdc2 (2cvd C:2-75)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class sigma GST [81362] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89705] (4 PDB entries)
   synonym: hematopoietic prostaglandin D synthase

8. Domain d2cvdc2: 2cvd C:2-75 [130866]
   Other proteins in same PDB: d2cvda1, d2cvdb1, d2cvdc1, d2cvdd1
   automatically matched to d1iyha2
   complexed with gol, gsh, hql, mg

Details for d2cvdc2

PDB Entry: 2cvd, 1.45 Å

PDB Description: Crystal structure analysis of human hematopoietic prostaglandin D synthase complexed with HQL-79

PDB Compounds: (C:) glutathione-requiring prostaglandin d synthase

SCOP Domain Sequences for d2cvdc2:

Sequence; same for both SEQRES and ATOM records:

>d2cvdc2 c.47.1.5 (C:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

Timeline for d2cvdc2:

• d2cvdc2 is new in SCOP 1.73
  
• d2cvdc2 appears in SCOP 1.75
  
• d2cvdc2 appears in the current release, SCOPe 2.08