Lineage for d2cvdc1 (2cvd C:76-199)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491601Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1491602Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1491603Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1492074Protein Class sigma GST [81351] (5 species)
  7. 1492087Species Human (Homo sapiens) [TaxId:9606] [89061] (7 PDB entries)
    Uniprot O60760; synonym: hematopoietic prostaglandin D synthase
  8. 1492090Domain d2cvdc1: 2cvd C:76-199 [130865]
    Other proteins in same PDB: d2cvda2, d2cvdb2, d2cvdc2, d2cvdd2
    automated match to d1iyha1
    complexed with gol, gsh, hql, mg

Details for d2cvdc1

PDB Entry: 2cvd (more details), 1.45 Å

PDB Description: Crystal structure analysis of human hematopoietic prostaglandin D synthase complexed with HQL-79
PDB Compounds: (C:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d2cvdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cvdc1 a.45.1.1 (C:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOPe Domain Coordinates for d2cvdc1:

Click to download the PDB-style file with coordinates for d2cvdc1.
(The format of our PDB-style files is described here.)

Timeline for d2cvdc1: