SCOPe 2.04: Domain d2cvdd1: 2cvd D:76-199

Lineage for d2cvdd1 (2cvd D:76-199)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class sigma GST [81351] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89061] (7 PDB entries)
   Uniprot O60760; synonym: hematopoietic prostaglandin D synthase

8. Domain d2cvdd1: 2cvd D:76-199 [130867]
   Other proteins in same PDB: d2cvda2, d2cvdb2, d2cvdc2, d2cvdd2
   automated match to d1iyha1
   complexed with gol, gsh, hql, mg

Details for d2cvdd1

PDB Entry: 2cvd, 1.45 Å

PDB Description: Crystal structure analysis of human hematopoietic prostaglandin D synthase complexed with HQL-79

PDB Compounds: (D:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d2cvdd1:

Sequence; same for both SEQRES and ATOM records:

>d2cvdd1 a.45.1.1 (D:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

Timeline for d2cvdd1:

• d2cvdd1 first appeared in SCOP 1.73
  
• d2cvdd1 appears in SCOPe 2.03
  
• d2cvdd1 appears in SCOPe 2.05
  
• d2cvdd1 appears in the current release, SCOPe 2.08