![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.8: CoA-binding domain [51900] (6 proteins) |
![]() | Protein Acetate-CoA ligase alpha chain, AcdA, N-terminal domain [141936] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [141937] (1 PDB entry) Uniprot O58493 1-129 |
![]() | Domain d2csub1: 2csu B:1-129 [130784] Other proteins in same PDB: d2csua2, d2csua3, d2csub2, d2csub3 automated match to d2csua1 |
PDB Entry: 2csu (more details), 2.2 Å
SCOPe Domain Sequences for d2csub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2csub1 c.2.1.8 (B:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} mldyffnpkgiavigasndpkklgyevfknlkeykkgkvypvnikeeevqgvkayksvkd ipdeidlaiivvpkrfvkdtliqcgekgvkgvviitagfgetgeegkreekelveiahky gmriigpnc
Timeline for d2csub1: