SCOPe 2.08: Domain d2csua3: 2csu A:291-453

Lineage for d2csua3 (2csu A:291-453)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)

5. Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
   contain additional N-terminal strand "0", antiparallel to strand 2

6. Protein Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 [142043] (1 species)
   duplication: tandem repeat of two similar domains, structurally and functionally related to the C-terminal domains of Succinyl-CoA synthetase subunits; the first domain (2) is related to the alpha-chain domain, whereas the second domain (3) is related to the beta-chain domain

7. Species Pyrococcus horikoshii [TaxId:53953] [142044] (1 PDB entry)
   Uniprot O58493 130-290! Uniprot O58493 291-453
   PH0766

8. Domain d2csua3: 2csu A:291-453 [130783]
   Other proteins in same PDB: d2csua1, d2csub1

Details for d2csua3

PDB Entry: 2csu, 2.2 Å

PDB Description: Crystal structure of PH0766 from Pyrococcus horikoshii OT3

PDB Compounds: (A:) 457aa long hypothetical protein

SCOPe Domain Sequences for d2csua3:

Sequence; same for both SEQRES and ATOM records:

>d2csua3 c.23.4.1 (A:291-453) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]}
prgnkvaimtnaggpgvltadeldkrglklatleektieelrsflppmaavknpvdmias
argedyyrtaklllqdpnvdmliaicvvptfagmtltehaegiiravkevnnekpvlamf
magyvsekakellekngiptyerpedvasaayalveqaknvgi

Timeline for d2csua3:

• d2csua3 first appeared in SCOP 1.73
  
• d2csua3 appears in SCOPe 2.07