Lineage for d2csub2 (2csu B:130-290)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856236Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2856237Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 2856238Protein Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 [142043] (1 species)
    duplication: tandem repeat of two similar domains, structurally and functionally related to the C-terminal domains of Succinyl-CoA synthetase subunits; the first domain (2) is related to the alpha-chain domain, whereas the second domain (3) is related to the beta-chain domain
  7. 2856239Species Pyrococcus horikoshii [TaxId:53953] [142044] (1 PDB entry)
    Uniprot O58493 130-290! Uniprot O58493 291-453
    PH0766
  8. 2856242Domain d2csub2: 2csu B:130-290 [130785]
    Other proteins in same PDB: d2csua1, d2csub1
    automated match to d2csua2

Details for d2csub2

PDB Entry: 2csu (more details), 2.2 Å

PDB Description: Crystal structure of PH0766 from Pyrococcus horikoshii OT3
PDB Compounds: (B:) 457aa long hypothetical protein

SCOPe Domain Sequences for d2csub2:

Sequence, based on SEQRES records: (download)

>d2csub2 c.23.4.1 (B:130-290) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]}
vgimnthvdlnatfitvakkgnvafisqsgalgagivyktikedigfskfisvgnmadvd
faelmeyladteedkaialyiegvrngkkfmevakrvtkkkpiialkagksesgaraass
htgslagswkiyeaafkqsgvlvantidemlsmarafsqpl

Sequence, based on observed residues (ATOM records): (download)

>d2csub2 c.23.4.1 (B:130-290) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]}
vgimnthvdlnatfitvakkgnvafisqsgalgagivyktikedigfskfisvgnmadvd
faelmeyladteedkaialyiegvrngkkfmevakrvtkkkpiialkagkkiyeaafkqs
gvlvantidemlsmarafsqpl

SCOPe Domain Coordinates for d2csub2:

Click to download the PDB-style file with coordinates for d2csub2.
(The format of our PDB-style files is described here.)

Timeline for d2csub2: