Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
Protein GTPase domain of the signal recognition particle receptor FtsY [52666] (3 species) |
Species Thermus aquaticus [TaxId:271] [102374] (5 PDB entries) |
Domain d2cnwd2: 2cnw D:97-303 [130656] Other proteins in same PDB: d2cnwa1, d2cnwa2, d2cnwb1, d2cnwb2, d2cnwc1, d2cnwc2, d2cnwd1, d2cnwe1, d2cnwf1 automatically matched to d1okkd2 protein/RNA complex; complexed with 5gp, alf, gdp, mg |
PDB Entry: 2cnw (more details), 2.39 Å
SCOPe Domain Sequences for d2cnwd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cnwd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} pvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdtfraaggtqlsewgkrl sipviqgpegtdpaalaydavqamkargydllfvdtagrlhtkhnlmeelkkvkraiaka dpeepkevwlvldavtgqngleqakkfheavgltgvivtkldgtakggvlipivrtlkvp ikfvgvgegpddlqpfdpeafvealle
Timeline for d2cnwd2: