Lineage for d2cnwa1 (2cnw A:4-88)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1263159Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1263719Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) (S)
  5. 1263720Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)
  6. 1263740Protein Signal sequence recognition protein Ffh [47366] (3 species)
  7. 1263751Species Thermus aquaticus [TaxId:271] [47367] (18 PDB entries)
  8. 1263774Domain d2cnwa1: 2cnw A:4-88 [130649]
    Other proteins in same PDB: d2cnwa2, d2cnwb2, d2cnwc2, d2cnwd1, d2cnwd2, d2cnwe1, d2cnwe2, d2cnwf1, d2cnwf2
    automated match to d1okka1
    protein/RNA complex; complexed with 5gp, alf, gdp, mg

Details for d2cnwa1

PDB Entry: 2cnw (more details), 2.39 Å

PDB Description: gdpalf4 complex of the srp gtpases ffh and ftsy
PDB Compounds: (A:) signal recognition particle protein

SCOPe Domain Sequences for d2cnwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cnwa1 a.24.13.1 (A:4-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
qlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreealgkq
vlesltpaevilatvyealkealgg

SCOPe Domain Coordinates for d2cnwa1:

Click to download the PDB-style file with coordinates for d2cnwa1.
(The format of our PDB-style files is described here.)

Timeline for d2cnwa1: