SCOPe 2.03: Domain d2cnwf2: 2cnw F:97-303

Lineage for d2cnwf2 (2cnw F:97-303)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein GTPase domain of the signal recognition particle receptor FtsY [52666] (3 species)

7. Species Thermus aquaticus [TaxId:271] [102374] (5 PDB entries)

8. Domain d2cnwf2: 2cnw F:97-303 [130660]
   Other proteins in same PDB: d2cnwa1, d2cnwa2, d2cnwb1, d2cnwb2, d2cnwc1, d2cnwc2, d2cnwd1, d2cnwe1, d2cnwf1
   automatically matched to d1okkd2
   protein/RNA complex; complexed with 5gp, alf, gdp, mg

Details for d2cnwf2

PDB Entry: 2cnw, 2.39 Å

PDB Description: gdpalf4 complex of the srp gtpases ffh and ftsy

PDB Compounds: (F:) cell division protein ftsy

SCOPe Domain Sequences for d2cnwf2:

Sequence; same for both SEQRES and ATOM records:

>d2cnwf2 c.37.1.10 (F:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}
pvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdtfraaggtqlsewgkrl
sipviqgpegtdpaalaydavqamkargydllfvdtagrlhtkhnlmeelkkvkraiaka
dpeepkevwlvldavtgqngleqakkfheavgltgvivtkldgtakggvlipivrtlkvp
ikfvgvgegpddlqpfdpeafvealle

Timeline for d2cnwf2:

• d2cnwf2 first appeared in SCOP 1.73
  
• d2cnwf2 appears in SCOPe 2.02
  
• d2cnwf2 appears in SCOPe 2.04
  
• d2cnwf2 appears in the current release, SCOPe 2.08