SCOPe 2.08: Domain d2clzh2: 2clz H:3-180

Lineage for d2clzh2 (2clz H:3-180)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (23 PDB entries)

8. Domain d2clzh2: 2clz H:3-180 [130607]
   Other proteins in same PDB: d2clza1, d2clzb_, d2clzh1, d2clzp_
   automatically matched to d1ddha2
   mutant

Details for d2clzh2

PDB Entry: 2clz, 1.9 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and pbm1 peptide

PDB Compounds: (H:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d2clzh2:

Sequence; same for both SEQRES and ATOM records:

>d2clzh2 d.19.1.1 (H:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hslryfvtavsrpglgeprfisvgyvdntefvrfdsdaenpryeprarwmeqegpeywer
etqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydgcd
yialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll

Timeline for d2clzh2:

• d2clzh2 first appeared in SCOP 1.73
  
• d2clzh2 appears in SCOPe 2.07