Lineage for d2clza1 (2clz A:182-274)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
    Uniprot P01901 22-299
  8. Domain d2clza1: 2clz A:182-274 [130603]
    Other proteins in same PDB: d2clza2, d2clzb_, d2clzh2, d2clzp_
    automatically matched to d1ddha1
    mutant

Details for d2clza1

PDB Entry: 2clz (more details), 1.9 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and pbm1 peptide
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d2clza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2clza1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOPe Domain Coordinates for d2clza1 are not available.

Timeline for d2clza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2clza2
View in 3D
Domains from other chains:
(mouse over for more information)
d2clzb_, d2clzh1, d2clzh2, d2clzp_