SCOPe 2.08: Domain d2clzp_: 2clz P:

Lineage for d2clzp_ (2clz P:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
   Uniprot P01887

8. Domain d2clzp_: 2clz P: [130608]
   Other proteins in same PDB: d2clza1, d2clza2, d2clzh1, d2clzh2
   automated match to d1bz9b_
   mutant

Details for d2clzp_

PDB Entry: 2clz, 1.9 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and pbm1 peptide

PDB Compounds: (P:) beta-2 microglobulin

SCOPe Domain Sequences for d2clzp_:

Sequence; same for both SEQRES and ATOM records:

>d2clzp_ b.1.1.2 (P:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d2clzp_:

• d2clzp_ first appeared in SCOP 1.73, called d2clzp1
  
• d2clzp_ appears in SCOPe 2.07