SCOPe 2.08: Domain d2clzh1: 2clz H:182-274

Lineage for d2clzh1 (2clz H:182-274)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries)
   Uniprot P01901 22-299

8. Domain d2clzh1: 2clz H:182-274 [130606]
   Other proteins in same PDB: d2clza2, d2clzb_, d2clzh2, d2clzp_
   automatically matched to d1ddha1
   mutant

Details for d2clzh1

PDB Entry: 2clz, 1.9 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and pbm1 peptide

PDB Compounds: (H:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d2clzh1:

Sequence; same for both SEQRES and ATOM records:

>d2clzh1 b.1.1.2 (H:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

Timeline for d2clzh1:

• d2clzh1 first appeared in SCOP 1.73
  
• d2clzh1 appears in SCOPe 2.07