Lineage for d2ck3d1 (2ck3 D:358-475)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717310Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 2717381Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species)
  7. 2717430Species Cow (Bos taurus) [TaxId:9913] [88929] (18 PDB entries)
    Uniprot P00829
  8. 2717443Domain d2ck3d1: 2ck3 D:358-475 [130553]
    Other proteins in same PDB: d2ck3a1, d2ck3a2, d2ck3a3, d2ck3b1, d2ck3b2, d2ck3b3, d2ck3c1, d2ck3c2, d2ck3c3, d2ck3d2, d2ck3d3, d2ck3e2, d2ck3e3, d2ck3f2, d2ck3f3, d2ck3g_, d2ck3h1, d2ck3h2, d2ck3i_
    automated match to d1e79d1
    complexed with adp, anp, azi, mg, po4

Details for d2ck3d1

PDB Entry: 2ck3 (more details), 1.9 Å

PDB Description: Azide inhibited bovine F1-ATPase
PDB Compounds: (D:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d2ck3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ck3d1 a.69.1.1 (D:358-475) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadklae

SCOPe Domain Coordinates for d2ck3d1:

Click to download the PDB-style file with coordinates for d2ck3d1.
(The format of our PDB-style files is described here.)

Timeline for d2ck3d1: