SCOPe 2.08: Domain d2ck3a1: 2ck3 A:380-510

Lineage for d2ck3a1 (2ck3 A:380-510)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase alpha subunit, domain 3 [88886] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88893] (15 PDB entries)
   Uniprot P19483

8. Domain d2ck3a1: 2ck3 A:380-510 [145033]
   Other proteins in same PDB: d2ck3a2, d2ck3a3, d2ck3b2, d2ck3b3, d2ck3c2, d2ck3c3, d2ck3d1, d2ck3d2, d2ck3d3, d2ck3e1, d2ck3e2, d2ck3e3, d2ck3f1, d2ck3f2, d2ck3f3, d2ck3g_, d2ck3h1, d2ck3h2, d2ck3i_
   automated match to d1w0ja1
   complexed with adp, anp, azi, mg, po4

Details for d2ck3a1

PDB Entry: 2ck3, 1.9 Å

PDB Description: Azide inhibited bovine F1-ATPase

PDB Compounds: (A:) ATP synthase subunit alpha, mitochondrial

SCOPe Domain Sequences for d2ck3a1:

Sequence; same for both SEQRES and ATOM records:

>d2ck3a1 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

Timeline for d2ck3a1:

• d2ck3a1 first appeared in SCOP 1.75
  
• d2ck3a1 appears in SCOPe 2.07