Lineage for d2ck3d3 (2ck3 D:82-357)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869423Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2869554Protein Central domain of beta subunit of F1 ATP synthase [88779] (5 species)
  7. 2869603Species Cow (Bos taurus) [TaxId:9913] [88780] (18 PDB entries)
    Uniprot P00829
  8. 2869616Domain d2ck3d3: 2ck3 D:82-357 [130555]
    Other proteins in same PDB: d2ck3a1, d2ck3a2, d2ck3a3, d2ck3b1, d2ck3b2, d2ck3b3, d2ck3c1, d2ck3c2, d2ck3c3, d2ck3d1, d2ck3d2, d2ck3e1, d2ck3e2, d2ck3f1, d2ck3f2, d2ck3g_, d2ck3h1, d2ck3h2, d2ck3i_
    automated match to d1e79d3
    complexed with adp, anp, azi, mg, po4

Details for d2ck3d3

PDB Entry: 2ck3 (more details), 1.9 Å

PDB Description: Azide inhibited bovine F1-ATPase
PDB Compounds: (D:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d2ck3d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ck3d3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

SCOPe Domain Coordinates for d2ck3d3:

Click to download the PDB-style file with coordinates for d2ck3d3.
(The format of our PDB-style files is described here.)

Timeline for d2ck3d3: