Lineage for d2ck3h2 (2ck3 H:17-100)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073725Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
    pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns
  4. 2073726Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) (S)
  5. 2073727Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (2 protein domains)
  6. 2073728Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (3 species)
    delta subunit in mitochondria
  7. 2073737Species Cow (Bos taurus) [TaxId:9913] [51348] (5 PDB entries)
  8. 2073740Domain d2ck3h2: 2ck3 H:17-100 [130564]
    Other proteins in same PDB: d2ck3a1, d2ck3a2, d2ck3a3, d2ck3b1, d2ck3b2, d2ck3b3, d2ck3c1, d2ck3c2, d2ck3c3, d2ck3d1, d2ck3d2, d2ck3d3, d2ck3e1, d2ck3e2, d2ck3e3, d2ck3f1, d2ck3f2, d2ck3f3, d2ck3g_, d2ck3h1, d2ck3i_
    automated match to d1e79h2
    complexed with adp, anp, azi, mg, po4

Details for d2ck3h2

PDB Entry: 2ck3 (more details), 1.9 Å

PDB Description: Azide inhibited bovine F1-ATPase
PDB Compounds: (H:) ATP synthase subunit delta, mitochondrial

SCOPe Domain Sequences for d2ck3h2:

Sequence, based on SEQRES records: (download)

>d2ck3h2 b.93.1.1 (H:17-100) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
sftfasptqvffnsanvrqvdvptqtgafgilaahvptlqvlrpglvvvhaedgttskyf
vssgsvtvnadssvqllaeeavtl

Sequence, based on observed residues (ATOM records): (download)

>d2ck3h2 b.93.1.1 (H:17-100) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
sftfasptqvffnqvdvptlrpglvvvfvssgsqllaeeavtl

SCOPe Domain Coordinates for d2ck3h2:

Click to download the PDB-style file with coordinates for d2ck3h2.
(The format of our PDB-style files is described here.)

Timeline for d2ck3h2: