SCOPe 2.08: Domain d2ck3h2: 2ck3 H:17-100

Lineage for d2ck3h2 (2ck3 H:17-100)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
   pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns

4. Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family)

5. Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (2 proteins)

6. Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (3 species)
   delta subunit in mitochondria

7. Species Cow (Bos taurus) [TaxId:9913] [51348] (5 PDB entries)

8. Domain d2ck3h2: 2ck3 H:17-100 [130564]
   Other proteins in same PDB: d2ck3a1, d2ck3a2, d2ck3a3, d2ck3b1, d2ck3b2, d2ck3b3, d2ck3c1, d2ck3c2, d2ck3c3, d2ck3d1, d2ck3d2, d2ck3d3, d2ck3e1, d2ck3e2, d2ck3e3, d2ck3f1, d2ck3f2, d2ck3f3, d2ck3g_, d2ck3h1, d2ck3i_
   automated match to d1e79h2
   complexed with adp, anp, azi, mg, po4
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2ck3h2

PDB Entry: 2ck3, 1.9 Å

PDB Description: Azide inhibited bovine F1-ATPase

PDB Compounds: (H:) ATP synthase subunit delta, mitochondrial

SCOPe Domain Sequences for d2ck3h2:

Sequence, based on SEQRES records:

>d2ck3h2 b.93.1.1 (H:17-100) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
sftfasptqvffnsanvrqvdvptqtgafgilaahvptlqvlrpglvvvhaedgttskyf
vssgsvtvnadssvqllaeeavtl

Sequence, based on observed residues (ATOM records):

>d2ck3h2 b.93.1.1 (H:17-100) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
sftfasptqvffnqvdvptlrpglvvvfvssgsqllaeeavtl

Timeline for d2ck3h2:

• d2ck3h2 first appeared in SCOP 1.73
  
• d2ck3h2 appears in SCOPe 2.07