Lineage for d2cg4a2 (2cg4 A:67-152)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2949722Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (5 proteins)
    octamer: tetramer of dimers
    automatically mapped to Pfam PF01037
  6. 2949747Protein Regulatory protein AsnC [143261] (1 species)
  7. 2949748Species Escherichia coli [TaxId:562] [143262] (1 PDB entry)
    Uniprot P0ACI6 67-152
  8. 2949749Domain d2cg4a2: 2cg4 A:67-152 [130418]
    Other proteins in same PDB: d2cg4a1, d2cg4b1
    complexed with asn, mg

Details for d2cg4a2

PDB Entry: 2cg4 (more details), 2.4 Å

PDB Description: structure of e.coli asnc
PDB Compounds: (A:) regulatory protein asnc

SCOPe Domain Sequences for d2cg4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cg4a2 d.58.4.2 (A:67-152) Regulatory protein AsnC {Escherichia coli [TaxId: 562]}
dvgcfigiilksakdypsalaklesldevteayyttghysifikvmcrsidalqhvlink
iqtideiqstetlivlqnpimrtikp

SCOPe Domain Coordinates for d2cg4a2:

Click to download the PDB-style file with coordinates for d2cg4a2.
(The format of our PDB-style files is described here.)

Timeline for d2cg4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cg4a1