Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (5 proteins) octamer: tetramer of dimers automatically mapped to Pfam PF01037 |
Protein Regulatory protein AsnC [143261] (1 species) |
Species Escherichia coli [TaxId:562] [143262] (1 PDB entry) Uniprot P0ACI6 67-152 |
Domain d2cg4a2: 2cg4 A:67-152 [130418] Other proteins in same PDB: d2cg4a1, d2cg4b1 complexed with asn, mg |
PDB Entry: 2cg4 (more details), 2.4 Å
SCOPe Domain Sequences for d2cg4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cg4a2 d.58.4.2 (A:67-152) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} dvgcfigiilksakdypsalaklesldevteayyttghysifikvmcrsidalqhvlink iqtideiqstetlivlqnpimrtikp
Timeline for d2cg4a2: