![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.32: Lrp/AsnC-like transcriptional regulator N-terminal domain [68967] (4 proteins) Swapped dimer with the "wing" C-terminal strands automatically mapped to Pfam PF13412 |
![]() | Protein Regulatory protein AsnC [140235] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [140236] (1 PDB entry) Uniprot P0ACI6 4-66 |
![]() | Domain d2cg4b1: 2cg4 B:4-66 [130419] Other proteins in same PDB: d2cg4a2, d2cg4b2 automated match to d2cg4a1 complexed with asn, mg |
PDB Entry: 2cg4 (more details), 2.4 Å
SCOPe Domain Sequences for d2cg4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cg4b1 a.4.5.32 (B:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} ylidnldrgilealmgnartayaelakqfgvspetihvrvekmkqagiitgaridvspkq lgy
Timeline for d2cg4b1: