![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (5 proteins) octamer: tetramer of dimers automatically mapped to Pfam PF01037 |
![]() | Protein Regulatory protein AsnC [143261] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [143262] (1 PDB entry) Uniprot P0ACI6 67-152 |
![]() | Domain d2cg4b2: 2cg4 B:67-152 [130420] Other proteins in same PDB: d2cg4a1, d2cg4b1 automated match to d2cg4a2 complexed with asn, mg |
PDB Entry: 2cg4 (more details), 2.4 Å
SCOPe Domain Sequences for d2cg4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cg4b2 d.58.4.2 (B:67-152) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} dvgcfigiilksakdypsalaklesldevteayyttghysifikvmcrsidalqhvlink iqtideiqstetlivlqnpimrtikp
Timeline for d2cg4b2: