PDB entry 2cg4

View 2cg4 on RCSB PDB site
Description: structure of e.coli asnc
Class: transcription
Keywords: asnc, DNA binding, ffrp, lrp family, transcription, DNA-binding, transcription regulation
Deposited on 2006-02-27, released 2006-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.232
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: regulatory protein asnc
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACI6 (Start-151)
      • engineered mutation (36)
    Domains in SCOPe 2.07: d2cg4a1, d2cg4a2
  • Chain 'B':
    Compound: regulatory protein asnc
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACI6 (Start-151)
      • engineered mutation (36)
    Domains in SCOPe 2.07: d2cg4b1, d2cg4b2
  • Heterogens: ASN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cg4A (A:)
    menylidnldrgilealmgnartayaelakqfgvspetihvrvekmkqagiitgaridvs
    pkqlgydvgcfigiilksakdypsalaklesldevteayyttghysifikvmcrsidalq
    hvlinkiqtideiqstetlivlqnpimrtikp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cg4A (A:)
    ylidnldrgilealmgnartayaelakqfgvspetihvrvekmkqagiitgaridvspkq
    lgydvgcfigiilksakdypsalaklesldevteayyttghysifikvmcrsidalqhvl
    inkiqtideiqstetlivlqnpimrtikp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cg4B (B:)
    menylidnldrgilealmgnartayaelakqfgvspetihvrvekmkqagiitgaridvs
    pkqlgydvgcfigiilksakdypsalaklesldevteayyttghysifikvmcrsidalq
    hvlinkiqtideiqstetlivlqnpimrtikp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cg4B (B:)
    ylidnldrgilealmgnartayaelakqfgvspetihvrvekmkqagiitgaridvspkq
    lgydvgcfigiilksakdypsalaklesldevteayyttghysifikvmcrsidalqhvl
    inkiqtideiqstetlivlqnpimrtikp