SCOPe 2.08: Domain d2ceaf2: 2cea F:150-402

Lineage for d2ceaf2 (2cea F:150-402)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein AAA domain of cell division protein FtsH [82418] (3 species)
   ATP-dependent protease

7. Species Thermotoga maritima [TaxId:2336] [142325] (3 PDB entries)
   Uniprot Q9WZ49 150-402

8. Domain d2ceaf2: 2cea F:150-402 [130343]
   Other proteins in same PDB: d2ceaa1, d2ceab1, d2ceac1, d2cead1, d2ceae1, d2ceaf1
   automated match to d2ce7a2
   complexed with adp, mg, zn

Details for d2ceaf2

PDB Entry: 2cea, 2.75 Å

PDB Description: cell division protein ftsh

PDB Compounds: (F:) cell division protein ftsh

SCOPe Domain Sequences for d2ceaf2:

Sequence, based on SEQRES records:

>d2ceaf2 c.37.1.20 (F:150-402) AAA domain of cell division protein FtsH {Thermotoga maritima [TaxId: 2336]}
ykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgktl
laravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrhr
gaglggghdereqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvd
ppdmlgrkkileihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdki
tmkdfeeaidrvi

Sequence, based on observed residues (ATOM records):

>d2ceaf2 c.37.1.20 (F:150-402) AAA domain of cell division protein FtsH {Thermotoga maritima [TaxId: 2336]}
ykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgktl
laravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrde
reqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdppdmlgrkki
leihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdkitmkdfeeaid
rvi

Timeline for d2ceaf2:

• d2ceaf2 first appeared in SCOP 1.73
  
• d2ceaf2 appears in SCOPe 2.07