Class a: All alpha proteins [46456] (290 folds) |
Fold a.269: FtsH protease domain-like [140989] (1 superfamily) array of 6 helices and a 2-stranded beta-ribbon |
Superfamily a.269.1: FtsH protease domain-like [140990] (1 family) contains zincin-like (55486) metal-binding motif HExxH, embedded into a topologically different fold automatically mapped to Pfam PF01434 |
Family a.269.1.1: FtsH protease domain-like [140991] (2 proteins) Pfam PF01434; Peptidase family M41 |
Protein Cell division protein FtsH, C-terminal domain [140992] (2 species) |
Species Thermotoga maritima [TaxId:2336] [140994] (2 PDB entries) Uniprot Q9WZ49 411-603 |
Domain d2ceae1: 2cea E:411-603 [130340] Other proteins in same PDB: d2ceaa2, d2ceab2, d2ceac2, d2cead2, d2ceae2, d2ceaf2 automated match to d2ce7a1 complexed with adp, mg, zn |
PDB Entry: 2cea (more details), 2.75 Å
SCOPe Domain Sequences for d2ceae1:
Sequence, based on SEQRES records: (download)
>d2ceae1 a.269.1.1 (E:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} lispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpeedkylvsrn elldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelgplawgkee qevflgkeitrlrnyseevaskideevkkivtncyerakeiirkyrkqldniveilleke tiegdelrrilse
>d2ceae1 a.269.1.1 (E:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} lispaekriiayheaghavvstvvpngepvhrisiikylvsrnelldkltallggraaee vvfgdvtsgaandierateiarnmvcqlgmseelgplawgklrnyseevaskideevkki vtncyerakeiirkyrkqldniveilleketiegdelrrilse
Timeline for d2ceae1: