Lineage for d2ceaf2 (2cea F:150-402)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 697666Family c.37.1.20: Extended AAA-ATPase domain [81269] (27 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 697667Protein AAA domain of cell division protein FtsH [82418] (3 species)
    ATP-dependent protease
  7. 697670Species Thermotoga maritima [TaxId:2336] [142325] (2 PDB entries)
  8. 697682Domain d2ceaf2: 2cea F:150-402 [130343]
    Other proteins in same PDB: d2ceaa1, d2ceab1, d2ceac1, d2cead1, d2ceae1, d2ceaf1
    automatically matched to 2CE7 A:150-402
    complexed with adp, mg, zn; mutant

Details for d2ceaf2

PDB Entry: 2cea (more details), 2.75 Å

PDB Description: cell division protein ftsh
PDB Compounds: (F:) cell division protein ftsh

SCOP Domain Sequences for d2ceaf2:

Sequence, based on SEQRES records: (download)

>d2ceaf2 c.37.1.20 (F:150-402) AAA domain of cell division protein FtsH {Thermotoga maritima [TaxId: 2336]}
ykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgktl
laravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrhr
gaglggghdereqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvd
ppdmlgrkkileihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdki
tmkdfeeaidrvi

Sequence, based on observed residues (ATOM records): (download)

>d2ceaf2 c.37.1.20 (F:150-402) AAA domain of cell division protein FtsH {Thermotoga maritima [TaxId: 2336]}
ykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgktl
laravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrde
reqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdppdmlgrkki
leihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdkitmkdfeeaid
rvi

SCOP Domain Coordinates for d2ceaf2:

Click to download the PDB-style file with coordinates for d2ceaf2.
(The format of our PDB-style files is described here.)

Timeline for d2ceaf2: