![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
![]() | Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
![]() | Protein automated matches [254425] (18 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [255084] (2 PDB entries) |
![]() | Domain d2c77a2: 2c77 A:313-405 [130035] Other proteins in same PDB: d2c77a1, d2c77a3 automated match to d1b23p2 complexed with gnp, mg, peg |
PDB Entry: 2c77 (more details), 1.6 Å
SCOPe Domain Sequences for d2c77a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c77a2 b.44.1.0 (A:313-405) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv elikpvaleeglrfaireggrtvgagvvtkile
Timeline for d2c77a2: