Lineage for d2c77a1 (2c77 A:213-312)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2793298Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2793299Protein automated matches [226946] (29 species)
    not a true protein
  7. 2793446Species Thermus thermophilus HB8 [TaxId:300852] [255083] (2 PDB entries)
  8. 2793448Domain d2c77a1: 2c77 A:213-312 [130034]
    Other proteins in same PDB: d2c77a2, d2c77a3
    automated match to d1b23p1
    complexed with gnp, mg, peg

Details for d2c77a1

PDB Entry: 2c77 (more details), 1.6 Å

PDB Description: ef-tu complexed with a gtp analog and the antibiotic ge2270 a
PDB Compounds: (A:) Elongation factor Tu-B

SCOPe Domain Sequences for d2c77a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c77a1 b.43.3.0 (A:213-312) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp

SCOPe Domain Coordinates for d2c77a1:

Click to download the PDB-style file with coordinates for d2c77a1.
(The format of our PDB-style files is described here.)

Timeline for d2c77a1: