Lineage for d2c77a3 (2c77 A:2-212)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868771Species Thermus thermophilus HB8 [TaxId:300852] [255082] (2 PDB entries)
  8. 2868773Domain d2c77a3: 2c77 A:2-212 [130036]
    Other proteins in same PDB: d2c77a1, d2c77a2
    automated match to d1b23p3
    complexed with gnp, mg, peg

Details for d2c77a3

PDB Entry: 2c77 (more details), 1.6 Å

PDB Description: ef-tu complexed with a gtp analog and the antibiotic ge2270 a
PDB Compounds: (A:) Elongation factor Tu-B

SCOPe Domain Sequences for d2c77a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c77a3 c.37.1.8 (A:2-212) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
kgefirtkphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerargi
tintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehil
larqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleq
mhrnpktrrgenewvdkiwelldaideyipt

SCOPe Domain Coordinates for d2c77a3:

Click to download the PDB-style file with coordinates for d2c77a3.
(The format of our PDB-style files is described here.)

Timeline for d2c77a3: