SCOPe 2.08: Domain d2c54a1: 2c54 A:13-374

Lineage for d2c54a1 (2c54 A:13-374)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein GDP-mannose-3', 5'-epimerase [141890] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141891] (4 PDB entries)
   Uniprot Q93VR3 13-374! Uniprot Q93VR3 13-375

8. Domain d2c54a1: 2c54 A:13-374 [129877]
   Other proteins in same PDB: d2c54b_
   complexed with epe, fmt, gkd, gke, nad
   has additional subdomain(s) that are not in the common domain

Details for d2c54a1

PDB Entry: 2c54, 1.5 Å

PDB Description: gdp-mannose-3', 5' -epimerase (arabidopsis thaliana),k178r, with gdp- beta-l-gulose and gdp-4-keto-beta-l-gulose bound in active site.

PDB Compounds: (A:) GDP-mannose-3', 5'-epimerase

SCOPe Domain Sequences for d2c54a1:

Sequence; same for both SEQRES and ATOM records:

>d2c54a1 c.2.1.2 (A:13-374) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tykelereqywpsenlkisitgaggfiashiarrlkheghyviasdwkknehmtedmfcd
efhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimynntmisfnmieaari
ngikrffyassaciypefkqlettnvslkesdawpaepqdayglerlateelckhynkdf
giecrigrfhniygpfgtwkggrekapaafcrkaqtstdrfemwgdglqtrsftfidecv
egvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhipgpegvrgrnsdnnl
ikeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskvvgtqapvqlgslra
ad

Timeline for d2c54a1:

• d2c54a1 first appeared in SCOP 1.73
  
• d2c54a1 appears in SCOPe 2.07