![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
![]() | Protein GDP-mannose-3', 5'-epimerase [141890] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141891] (4 PDB entries) Uniprot Q93VR3 13-374! Uniprot Q93VR3 13-375 |
![]() | Domain d2c54a1: 2c54 A:13-374 [129877] Other proteins in same PDB: d2c54b_ complexed with epe, fmt, gkd, gke, nad |
PDB Entry: 2c54 (more details), 1.5 Å
SCOPe Domain Sequences for d2c54a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c54a1 c.2.1.2 (A:13-374) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} tykelereqywpsenlkisitgaggfiashiarrlkheghyviasdwkknehmtedmfcd efhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimynntmisfnmieaari ngikrffyassaciypefkqlettnvslkesdawpaepqdayglerlateelckhynkdf giecrigrfhniygpfgtwkggrekapaafcrkaqtstdrfemwgdglqtrsftfidecv egvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhipgpegvrgrnsdnnl ikeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskvvgtqapvqlgslra ad
Timeline for d2c54a1: