![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
![]() | Protein automated matches [227019] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [232826] (1 PDB entry) |
![]() | Domain d2c4jd2: 2c4j D:2-85 [129823] Other proteins in same PDB: d2c4ja1, d2c4jb1, d2c4jc1, d2c4jd1 automated match to d2c4jc2 complexed with gso; mutant |
PDB Entry: 2c4j (more details), 1.35 Å
SCOPe Domain Sequences for d2c4jd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c4jd2 c.47.1.5 (D:2-85) automated matches {Human (Homo sapiens) [TaxId: 9606]} pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp ylidgthkitqsnailryiarkhn
Timeline for d2c4jd2: