Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein automated matches [227019] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [232826] (1 PDB entry) |
Domain d2c4jb2: 2c4j B:2-85 [129819] Other proteins in same PDB: d2c4ja1, d2c4jb1, d2c4jc1, d2c4jd1 automated match to d2c4ja2 complexed with gso; mutant |
PDB Entry: 2c4j (more details), 1.35 Å
SCOPe Domain Sequences for d2c4jb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c4jb2 c.47.1.5 (B:2-85) automated matches {Human (Homo sapiens) [TaxId: 9606]} pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp ylidgthkitqsnailryiarkhn
Timeline for d2c4jb2: