Lineage for d2c4jb2 (2c4j B:2-85)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2877295Protein automated matches [227019] (4 species)
    not a true protein
  7. 2877296Species Human (Homo sapiens) [TaxId:9606] [232826] (1 PDB entry)
  8. 2877298Domain d2c4jb2: 2c4j B:2-85 [129819]
    Other proteins in same PDB: d2c4ja1, d2c4jb1, d2c4jc1, d2c4jd1
    automated match to d2c4ja2
    complexed with gso; mutant

Details for d2c4jb2

PDB Entry: 2c4j (more details), 1.35 Å

PDB Description: human glutathione-s-transferase m2-2 t210s mutant in complex with glutathione-styrene oxide conjugate
PDB Compounds: (B:) Glutathione S-transferase Mu 2

SCOPe Domain Sequences for d2c4jb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4jb2 c.47.1.5 (B:2-85) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

SCOPe Domain Coordinates for d2c4jb2:

Click to download the PDB-style file with coordinates for d2c4jb2.
(The format of our PDB-style files is described here.)

Timeline for d2c4jb2: