Lineage for d2c4jc1 (2c4j C:86-218)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713549Protein automated matches [226848] (14 species)
    not a true protein
  7. 2713569Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)
  8. 2713573Domain d2c4jc1: 2c4j C:86-218 [129820]
    Other proteins in same PDB: d2c4ja2, d2c4jb2, d2c4jc2, d2c4jd2
    automated match to d1hnaa1
    complexed with gso; mutant

Details for d2c4jc1

PDB Entry: 2c4j (more details), 1.35 Å

PDB Description: human glutathione-s-transferase m2-2 t210s mutant in complex with glutathione-styrene oxide conjugate
PDB Compounds: (C:) Glutathione S-transferase Mu 2

SCOPe Domain Sequences for d2c4jc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4jc1 a.45.1.1 (C:86-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk

SCOPe Domain Coordinates for d2c4jc1:

Click to download the PDB-style file with coordinates for d2c4jc1.
(The format of our PDB-style files is described here.)

Timeline for d2c4jc1: