PDB entry 2c4j

View 2c4j on RCSB PDB site
Description: human glutathione-s-transferase m2-2 t210s mutant in complex with glutathione-styrene oxide conjugate
Class: transferase
Keywords: glutathione, glutathione transferase, transferase, m2-2, multigene family
Deposited on 2005-10-20, released 2005-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.195
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase Mu 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C4J
      • engineered mutation (209)
    • Uniprot P28161 (1-217)
    Domains in SCOPe 2.07: d2c4ja1, d2c4ja2
  • Chain 'B':
    Compound: Glutathione S-transferase Mu 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C4J
      • engineered mutation (209)
    • Uniprot P28161 (1-217)
    Domains in SCOPe 2.07: d2c4jb1, d2c4jb2
  • Chain 'C':
    Compound: Glutathione S-transferase Mu 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C4J
      • engineered mutation (209)
    • Uniprot P28161 (1-217)
    Domains in SCOPe 2.07: d2c4jc1, d2c4jc2
  • Chain 'D':
    Compound: Glutathione S-transferase Mu 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C4J
      • engineered mutation (209)
    • Uniprot P28161 (1-217)
    Domains in SCOPe 2.07: d2c4jd1, d2c4jd2
  • Heterogens: GSO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c4jA (A:)
    mpmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
    pylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdf
    eklkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpn
    lkdfisrfeglekisaymkssrflprpvfskmavwgnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c4jA (A:)
    pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdfe
    klkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpnl
    kdfisrfeglekisaymkssrflprpvfskmavwgnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c4jB (B:)
    mpmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
    pylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdf
    eklkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpn
    lkdfisrfeglekisaymkssrflprpvfskmavwgnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c4jB (B:)
    pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdfe
    klkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpnl
    kdfisrfeglekisaymkssrflprpvfskmavwgnk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c4jC (C:)
    mpmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
    pylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdf
    eklkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpn
    lkdfisrfeglekisaymkssrflprpvfskmavwgnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c4jC (C:)
    pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdfe
    klkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpnl
    kdfisrfeglekisaymkssrflprpvfskmavwgnk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c4jD (D:)
    mpmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
    pylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdf
    eklkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpn
    lkdfisrfeglekisaymkssrflprpvfskmavwgnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c4jD (D:)
    pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdfe
    klkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpnl
    kdfisrfeglekisaymkssrflprpvfskmavwgnk