Lineage for d2c4jb2 (2c4j B:2-85)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168419Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 1168582Protein Class mu GST [81359] (3 species)
  7. 1168590Species Human (Homo sapiens) [TaxId:9606] [52867] (15 PDB entries)
    Uniprot P09488 ! Uniprot P28161
  8. 1168592Domain d2c4jb2: 2c4j B:2-85 [129819]
    Other proteins in same PDB: d2c4ja1, d2c4jb1, d2c4jc1, d2c4jd1
    automatically matched to d1hna_2
    complexed with gso; mutant

Details for d2c4jb2

PDB Entry: 2c4j (more details), 1.35 Å

PDB Description: human glutathione-s-transferase m2-2 t210s mutant in complex with glutathione-styrene oxide conjugate
PDB Compounds: (B:) Glutathione S-transferase Mu 2

SCOPe Domain Sequences for d2c4jb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4jb2 c.47.1.5 (B:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

SCOPe Domain Coordinates for d2c4jb2:

Click to download the PDB-style file with coordinates for d2c4jb2.
(The format of our PDB-style files is described here.)

Timeline for d2c4jb2: