SCOP 1.73: Domain d2c4jb2: 2c4j B:2-85

Lineage for d2c4jb2 (2c4j B:2-85)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class mu GST [81359] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52867] (15 PDB entries)

8. Domain d2c4jb2: 2c4j B:2-85 [129819]
   Other proteins in same PDB: d2c4ja1, d2c4jb1, d2c4jc1, d2c4jd1
   automatically matched to d1hna_2
   complexed with gso; mutant

Details for d2c4jb2

PDB Entry: 2c4j, 1.35 Å

PDB Description: human glutathione-s-transferase m2-2 t210s mutant in complex with glutathione-styrene oxide conjugate

PDB Compounds: (B:) Glutathione S-transferase Mu 2

SCOP Domain Sequences for d2c4jb2:

Sequence; same for both SEQRES and ATOM records:

>d2c4jb2 c.47.1.5 (B:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

Timeline for d2c4jb2:

• d2c4jb2 is new in SCOP 1.73
  
• d2c4jb2 appears in SCOP 1.75
  
• d2c4jb2 appears in the current release, SCOPe 2.08