| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (22 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
| Protein Class mu GST [81359] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52867] (15 PDB entries) |
| Domain d2c4ja2: 2c4j A:2-85 [129817] Other proteins in same PDB: d2c4ja1, d2c4jb1, d2c4jc1, d2c4jd1 automatically matched to d1hna_2 complexed with gso; mutant |
PDB Entry: 2c4j (more details), 1.35 Å
SCOP Domain Sequences for d2c4ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn
Timeline for d2c4ja2: