Lineage for d2c4jb1 (2c4j B:86-218)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 641765Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 641766Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 641767Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 641921Protein Class mu GST [81348] (3 species)
  7. 641929Species Human (Homo sapiens) [TaxId:9606] [47622] (15 PDB entries)
  8. 641931Domain d2c4jb1: 2c4j B:86-218 [129818]
    Other proteins in same PDB: d2c4ja2, d2c4jb2, d2c4jc2, d2c4jd2
    automatically matched to d1hna_1
    complexed with gso; mutant

Details for d2c4jb1

PDB Entry: 2c4j (more details), 1.35 Å

PDB Description: human glutathione-s-transferase m2-2 t210s mutant in complex with glutathione-styrene oxide conjugate
PDB Compounds: (B:) Glutathione S-transferase Mu 2

SCOP Domain Sequences for d2c4jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4jb1 a.45.1.1 (B:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk

SCOP Domain Coordinates for d2c4jb1:

Click to download the PDB-style file with coordinates for d2c4jb1.
(The format of our PDB-style files is described here.)

Timeline for d2c4jb1: