Lineage for d2c2vi_ (2c2v I:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546033Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2546034Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2546035Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2546288Protein automated matches [190124] (13 species)
    not a true protein
  7. 2546306Species Human (Homo sapiens) [TaxId:9606] [186848] (60 PDB entries)
  8. 2546422Domain d2c2vi_: 2c2v I: [129691]
    Other proteins in same PDB: d2c2vc1, d2c2vs1, d2c2vt_, d2c2vu_, d2c2vv_
    automated match to d1j7da_

Details for d2c2vi_

PDB Entry: 2c2v (more details), 2.9 Å

PDB Description: crystal structure of the chip-ubc13-uev1a complex
PDB Compounds: (I:) Ubiquitin-conjugating enzyme E2 variant 1

SCOPe Domain Sequences for d2c2vi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c2vi_ d.20.1.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmilgpprtiyenriyslk
iecgpkypeappfvrfvtkinmngvnssngvvdpraisvlakwqnsysikvvlqelrrlm
mskenmklpqppegqcysn

SCOPe Domain Coordinates for d2c2vi_:

Click to download the PDB-style file with coordinates for d2c2vi_.
(The format of our PDB-style files is described here.)

Timeline for d2c2vi_: