![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
![]() | Family g.44.1.0: automated matches [191345] (1 protein) not a true family |
![]() | Protein automated matches [190242] (4 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187013] (2 PDB entries) |
![]() | Domain d2c2vt_: 2c2v T: [129695] Other proteins in same PDB: d2c2vb_, d2c2vc1, d2c2ve_, d2c2vf_, d2c2vh_, d2c2vi_, d2c2vk_, d2c2vl_, d2c2vs1 automated match to d1t1ha_ |
PDB Entry: 2c2v (more details), 2.9 Å
SCOPe Domain Sequences for d2c2vt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c2vt_ g.44.1.0 (T:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dipdylcgkisfelmrepcitpsgitydrkdieehlqrvghfnpvtrspltqeqlipnla mkevidafisengwvedy
Timeline for d2c2vt_: