| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
| Family d.20.1.1: UBC-related [54496] (7 proteins) |
| Protein automated matches [190124] (13 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186848] (60 PDB entries) |
| Domain d2c2vf_: 2c2v F: [129689] Other proteins in same PDB: d2c2vc1, d2c2vs1, d2c2vt_, d2c2vu_, d2c2vv_ automated match to d1j7da_ |
PDB Entry: 2c2v (more details), 2.9 Å
SCOPe Domain Sequences for d2c2vf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c2vf_ d.20.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmilgpprtiyenriyslk
iecgpkypeappfvrfvtkinmngvnssngvvdpraisvlakwqnsysikvvlqelrrlm
mskenmklpqppegqcysn
Timeline for d2c2vf_: