SCOPe 2.08: Domain d2byzd1: 2byz D:1-253

Lineage for d2byzd1 (2byz D:1-253)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein automated matches [231410] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [254877] (9 PDB entries)

8. Domain d2byzd1: 2byz D:1-253 [129528]
   Other proteins in same PDB: d2byza2, d2byzb2, d2byzc2, d2byzd2
   automated match to d2bywa1
   complexed with dao, nh4; mutant

Details for d2byzd1

PDB Entry: 2byz, 1.95 Å

PDB Description: structure of e.coli kas i h298q mutant in complex with c12 fatty acid

PDB Compounds: (D:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d2byzd1:

Sequence; same for both SEQRES and ATOM records:

>d2byzd1 c.95.1.1 (D:1-253) automated matches {Escherichia coli [TaxId: 562]}
mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
eelehalargahi

Timeline for d2byzd1:

• d2byzd1 first appeared in SCOP 1.73
  
• d2byzd1 appears in SCOPe 2.07