Lineage for d2byzd1 (2byz D:1-253)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2523779Family c.95.1.1: Thiolase-related [53902] (10 proteins)
  6. 2524206Protein automated matches [231410] (2 species)
    not a true protein
  7. 2524207Species Escherichia coli [TaxId:562] [254877] (9 PDB entries)
  8. 2524231Domain d2byzd1: 2byz D:1-253 [129528]
    Other proteins in same PDB: d2byza2, d2byzb2, d2byzc2, d2byzd2
    automated match to d2bywa1
    complexed with dao, nh4; mutant

Details for d2byzd1

PDB Entry: 2byz (more details), 1.95 Å

PDB Description: structure of e.coli kas i h298q mutant in complex with c12 fatty acid
PDB Compounds: (D:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d2byzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2byzd1 c.95.1.1 (D:1-253) automated matches {Escherichia coli [TaxId: 562]}
mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
eelehalargahi

SCOPe Domain Coordinates for d2byzd1:

Click to download the PDB-style file with coordinates for d2byzd1.
(The format of our PDB-style files is described here.)

Timeline for d2byzd1: