Lineage for d2byzd2 (2byz D:254-406)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917660Species Escherichia coli [TaxId:562] [254878] (9 PDB entries)
  8. 2917674Domain d2byzd2: 2byz D:254-406 [129529]
    Other proteins in same PDB: d2byza1, d2byzb1, d2byzc1, d2byzd1
    automated match to d1ek4a2
    complexed with dao, nh4; mutant

Details for d2byzd2

PDB Entry: 2byz (more details), 1.95 Å

PDB Description: structure of e.coli kas i h298q mutant in complex with c12 fatty acid
PDB Compounds: (D:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d2byzd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2byzd2 c.95.1.0 (D:254-406) automated matches {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnsqgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

SCOPe Domain Coordinates for d2byzd2:

Click to download the PDB-style file with coordinates for d2byzd2.
(The format of our PDB-style files is described here.)

Timeline for d2byzd2: