SCOPe 2.08: Domain d2byzb2: 2byz B:254-406

Lineage for d2byzb2 (2byz B:254-406)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [254878] (9 PDB entries)

8. Domain d2byzb2: 2byz B:254-406 [129525]
   Other proteins in same PDB: d2byza1, d2byzb1, d2byzc1, d2byzd1
   automated match to d1ek4a2
   complexed with dao, nh4; mutant

Details for d2byzb2

PDB Entry: 2byz, 1.95 Å

PDB Description: structure of e.coli kas i h298q mutant in complex with c12 fatty acid

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d2byzb2:

Sequence; same for both SEQRES and ATOM records:

>d2byzb2 c.95.1.0 (B:254-406) automated matches {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnsqgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

Timeline for d2byzb2:

• d2byzb2 first appeared in SCOP 1.73
  
• d2byzb2 appears in SCOPe 2.07