Lineage for d2bykb1 (2byk B:11-99)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2699133Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)
  6. 2699134Protein Chrac-14 [140398] (1 species)
  7. 2699135Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140399] (2 PDB entries)
    Uniprot Q9V444 11-99
  8. 2699136Domain d2bykb1: 2byk B:11-99 [129487]
    Other proteins in same PDB: d2byka1, d2bykc_
    protein/DNA complex; complexed with so4

Details for d2bykb1

PDB Entry: 2byk (more details), 2.4 Å

PDB Description: histone fold heterodimer of the chromatin accessibility complex
PDB Compounds: (B:) chrac-14

SCOPe Domain Sequences for d2bykb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pnavigrlikealpesasvskearaaiaraasvfaifvtssstalahkqnhktitakdil
qtlteldfesfvpsltqdlevyrkvvkek

SCOPe Domain Coordinates for d2bykb1:

Click to download the PDB-style file with coordinates for d2bykb1.
(The format of our PDB-style files is described here.)

Timeline for d2bykb1: