SCOPe 2.07: Domain d2bykb1: 2byk B:11-99

Lineage for d2bykb1 (2byk B:11-99)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)

6. Protein Chrac-14 [140398] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140399] (2 PDB entries)
   Uniprot Q9V444 11-99

8. Domain d2bykb1: 2byk B:11-99 [129487]
   Other proteins in same PDB: d2byka1, d2bykc_
   protein/DNA complex; complexed with so4

Details for d2bykb1

PDB Entry: 2byk, 2.4 Å

PDB Description: histone fold heterodimer of the chromatin accessibility complex

PDB Compounds: (B:) chrac-14

SCOPe Domain Sequences for d2bykb1:

Sequence; same for both SEQRES and ATOM records:

>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pnavigrlikealpesasvskearaaiaraasvfaifvtssstalahkqnhktitakdil
qtlteldfesfvpsltqdlevyrkvvkek

Timeline for d2bykb1:

• d2bykb1 first appeared in SCOP 1.73
  
• d2bykb1 appears in SCOPe 2.06
  
• d2bykb1 appears in the current release, SCOPe 2.08