![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
![]() | Family a.22.1.3: TBP-associated factors, TAFs [47134] (13 proteins) |
![]() | Protein Chrac-14 [140398] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140399] (2 PDB entries) |
![]() | Domain d2bykb1: 2byk B:11-99 [129487] Other proteins in same PDB: d2byka1, d2bykc1 complexed with so4 |
PDB Entry: 2byk (more details), 2.4 Å
SCOP Domain Sequences for d2bykb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} pnavigrlikealpesasvskearaaiaraasvfaifvtssstalahkqnhktitakdil qtlteldfesfvpsltqdlevyrkvvkek
Timeline for d2bykb1: