Lineage for d2bykb1 (2byk B:11-99)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637441Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 637442Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 637737Family a.22.1.3: TBP-associated factors, TAFs [47134] (13 proteins)
  6. 637738Protein Chrac-14 [140398] (1 species)
  7. 637739Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140399] (2 PDB entries)
  8. 637740Domain d2bykb1: 2byk B:11-99 [129487]
    Other proteins in same PDB: d2byka1, d2bykc1
    complexed with so4

Details for d2bykb1

PDB Entry: 2byk (more details), 2.4 Å

PDB Description: histone fold heterodimer of the chromatin accessibility complex
PDB Compounds: (B:) chrac-14

SCOP Domain Sequences for d2bykb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pnavigrlikealpesasvskearaaiaraasvfaifvtssstalahkqnhktitakdil
qtlteldfesfvpsltqdlevyrkvvkek

SCOP Domain Coordinates for d2bykb1:

Click to download the PDB-style file with coordinates for d2bykb1.
(The format of our PDB-style files is described here.)

Timeline for d2bykb1: