SCOPe 2.08: Domain d2byjb_: 2byj B:

Lineage for d2byjb_ (2byj B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein automated matches [190152] (25 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255069] (1 PDB entry)

8. Domain d2byjb_: 2byj B: [129484]
   Other proteins in same PDB: d2byja1
   automated match to d2oata_
   complexed with plp; mutant

Details for d2byjb_

PDB Entry: 2byj, 3.02 Å

PDB Description: ornithine aminotransferase mutant y85i

PDB Compounds: (B:) ornithine aminotransferase

SCOPe Domain Sequences for d2byjb_:

Sequence; same for both SEQRES and ATOM records:

>d2byjb_ c.67.1.4 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpptsddifereykygahnyhplpvalergkgiylwdvegrkyfdflssisavnqghchp
kivnalksqvdkltltsrafynnvlgeyeeyitklfnyhkvlpmntgveagetacklark
wgytvkgiqkykakivfaagnfwgrtlsaissstdptsydgfgpfmpgfdiipyndlpal
eralqdpnvaafmvepiqgeagvvvpdpgylmgvrelctrhqvlfiadeiqtglartgrw
lavdyenvrpdivllgkalsgglypvsavlcdddimltikpgehgstyggnplgcrvaia
alevleeenlaenadklgiilrnelmklpsdvvtavrgkgllnaiviketkdwdawkvcl
rlrdngllakpthgdiirfapplvikedelresieiinktilsf

Timeline for d2byjb_:

• d2byjb_ first appeared in SCOP 1.73, called d2byjb1
  
• d2byjb_ appears in SCOPe 2.07